PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007586P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 304aa    MW: 32693 Da    PI: 9.8708
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007586P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.92.8e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l ++v+++G+++W++I++ ++ gR++k+c++rw + 
   MELO3C007586P1 12 KGPWSPEEDDALQRLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding53.17.2e-1766108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +++a++ +G++ W+tIar +  gRt++ +k++w++ 
   MELO3C007586P1  66 PFSPEEDETIIRAHANFGNR-WATIARLLT-GRTDNAVKNHWNST 108
                      89******************.********9.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.302762IPR017930Myb domain
SuperFamilySSF466895.24E-329105IPR009057Homeodomain-like
SMARTSM007172.0E-171160IPR001005SANT/Myb domain
PfamPF002493.3E-191257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-261365IPR009057Homeodomain-like
CDDcd001679.02E-171456No hitNo description
SMARTSM007172.1E-1463111IPR001005SANT/Myb domain
PROSITE profilePS5129420.41464113IPR017930Myb domain
CDDcd001671.02E-1166109No hitNo description
PfamPF002492.6E-1466108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2366112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MALTRKDMDR IKGPWSPEED DALQRLVQKH GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
QVEHRPFSPE EDETIIRAHA NFGNRWATIA RLLTGRTDNA VKNHWNSTLK RKCSLMMNEG  120
YEVDPNVQPM KKSLSAGAAV NASNGLYMSP GSPSGSDISD SSVPVVAPTV YRPVARTGGV  180
IPPGESAPSS ASDPPTSLFL SLPGVDSSRH SGSGSTAQVP LMAAFAQIQS MTTTEQVRTA  240
QPSGGAAEKI NGFGVFSADL MAVMQEMIKS EVKSYMEGKG LSEQRGRRCF QEAKAGGIKN  300
VSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-40111133105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-40111133105C-Myb DNA-Binding Domain
1msf_C2e-40111133105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00632PBMTransfer from PK28565.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440323.10.0PREDICTED: transcription factor MYB44
SwissprotQ9FDW11e-94MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0A0KJL50.0A0A0A0KJL5_CUCSA; Sucrose responsive element binding protein
STRINGVIT_07s0129g01050.t011e-121(Vitis vinifera)
STRINGPOPTR_0007s10490.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.14e-84myb domain protein r1